PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539086.1_FGP006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 100aa    MW: 11268 Da    PI: 11.0404
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539086.1_FGP006genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.72.2e-174996451
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
             bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51
                       ++r rr++kNRe+A rsR+RK+a++ +Le++v++L++eNk+L+ + e+
  KN539086.1_FGP006 49 DRRKRRMIKNRESAARSRARKQARVNNLETEVEQLKQENKMLRVKYEQ 96
                       799****************************************76655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.2E-94698IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-154897No hitNo description
PROSITE profilePS5021711.4548100IPR004827Basic-leucine zipper domain
PfamPF001703.5E-154996IPR004827Basic-leucine zipper domain
CDDcd147071.02E-185097No hitNo description
SuperFamilySSF579596.88E-125097No hitNo description
PROSITE patternPS0003605368IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MSPIFSASAS YHQQQHHLPA PAPLDGAILP ARRFGLDMCA AAGVPAAGDR RKRRMIKNRE  60
SAARSRARKQ ARVNNLETEV EQLKQENKML RVKYEQMVVD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126171e-130CP012617.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 9 sequence.
GenBankCT8359081e-130CT835908.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSN083I14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015611345.11e-52PREDICTED: uncharacterized protein LOC9271661
TrEMBLA0A0E0B5W92e-53A0A0E0B5W9_9ORYZ; Uncharacterized protein
TrEMBLA2Z3L02e-53A2Z3L0_ORYSI; Putative uncharacterized protein
TrEMBLI1QQV04e-53I1QQV0_ORYGL; Uncharacterized protein
STRINGBGIOSGA031176-PA7e-53(Oryza sativa Indica Group)
STRINGORGLA09G0142900.11e-52(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044